Recombinant Full Length Human TRMT44 Protein, GST-tagged

Cat.No. : TRMT44-3863HF
Product Overview : Human C4orf23 full-length ORF ( NP_689757.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 365 amino acids
Description : The protein encoded by this gene is a putative tRNA methyltransferase found in the cytoplasm. Defects in this gene may be a cause of partial epilepsy with pericentral spikes (PEPS), but that has not been proven definitively. [provided by RefSeq, May 2012]
Molecular Mass : 67.7 kDa
AA Sequence : MYGPQTQLEEDAITPNDKTLFPDVDWLIGNHSDELTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIKEVGFTCGFHVDEDCLRIPSTKRVCLVGKSRTYPSSREASVDEKRTQYIKSRRGCPVSPPGWELSPSPRWVAAGSAGHCDGQQALDARVGCVTRAWAAEHGAGPQAEGPWLPGFHPREKAERVRNCAALPRDFIDQVVLQVANLLLGGKQLNTRSSRNGSLKTWNGGESLSLAEVANELDTETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAELRPPRTTPRKKIS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRMT44 tRNA methyltransferase 44 homolog [ Homo sapiens (human) ]
Official Symbol TRMT44
Synonyms TRNA Methyltransferase 44 Homolog (S. Cerevisiae); Methyltransferase-Like Protein 19; Methyltransferase Like 19; C4orf23; METTL19; Probable TRNA (Uracil-O(2)-)-Methyltransferase; Chromosome 4 Open Reading Frame 23; EC 2.1.1.211; EC 2.1.1; TRM44; TRMT44; tRNA methyltransferase 44 homolog; probable tRNA (uracil-O(2)-)-methyltransferase; methyltransferase like 19; methyltransferase-like protein 19
Gene ID 152992
mRNA Refseq NM_001350233
Protein Refseq NP_001337162
MIM 614309
UniProt ID Q8IYL2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRMT44 Products

Required fields are marked with *

My Review for All TRMT44 Products

Required fields are marked with *

0
cart-icon
0
compare icon