Recombinant Human TRPA1 protein, His-SUMO-tagged

Cat.No. : TRPA1-345H
Product Overview : Recombinant Human TRPA1 protein(NP_015628)(957-1119aa), fused with two N-terminal tags, 6xHis tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 957-1119aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.2kDa
AA Sequence : IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name TRPA1 transient receptor potential cation channel, subfamily A, member 1 [ Homo sapiens ]
Official Symbol TRPA1
Synonyms TRPA1; transient receptor potential cation channel, subfamily A, member 1; ANKTM1, ankyrin like with transmembrane domains 1; transient receptor potential cation channel subfamily A member 1; transformation-sensitive protein p120; ankyrin-like with transmembrane domains 1; ankyrin-like with transmembrane domains protein 1; ANKTM1;
Gene ID 8989
mRNA Refseq NM_007332
Protein Refseq NP_015628
MIM 604775
UniProt ID O75762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPA1 Products

Required fields are marked with *

My Review for All TRPA1 Products

Required fields are marked with *

0
cart-icon