Recombinant Human TRPA1 protein, His-SUMO-tagged
Cat.No. : | TRPA1-345H |
Product Overview : | Recombinant Human TRPA1 protein(NP_015628)(957-1119aa), fused with two N-terminal tags, 6xHis tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 957-1119aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.2kDa |
AA Sequence : | IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRPA1 transient receptor potential cation channel, subfamily A, member 1 [ Homo sapiens ] |
Official Symbol | TRPA1 |
Synonyms | TRPA1; transient receptor potential cation channel, subfamily A, member 1; ANKTM1, ankyrin like with transmembrane domains 1; transient receptor potential cation channel subfamily A member 1; transformation-sensitive protein p120; ankyrin-like with transmembrane domains 1; ankyrin-like with transmembrane domains protein 1; ANKTM1; |
Gene ID | 8989 |
mRNA Refseq | NM_007332 |
Protein Refseq | NP_015628 |
MIM | 604775 |
UniProt ID | O75762 |
◆ Recombinant Proteins | ||
TRPA1-6298R | Recombinant Rat TRPA1 Protein | +Inquiry |
TRPA1-9653M | Recombinant Mouse TRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRPA1-343H | Recombinant Human TRPA1 Protein, His-tagged | +Inquiry |
TRPA1-18H | Recombinant Human TRPA1 Protein, N-GST-tagged | +Inquiry |
TRPA1-2844HB | Active Recombinant Full Length Human TRPA1 Protein, Flag-tagged, Biotin Labeled, Nanodisc | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPA1-1841HCL | Recombinant Human TRPA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPA1 Products
Required fields are marked with *
My Review for All TRPA1 Products
Required fields are marked with *