Recombinant Human TRUB2 protein, His-tagged
| Cat.No. : | TRUB2-3441H |
| Product Overview : | Recombinant Human TRUB2 protein(1-331 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-331 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TRUB2 TruB pseudouridine (psi) synthase homolog 2 (E. coli) [ Homo sapiens ] |
| Official Symbol | TRUB2 |
| Synonyms | TRUB2; TruB pseudouridine (psi) synthase homolog 2 (E. coli); probable tRNA pseudouridine synthase 2; CLONE24922; RP11-339B21.1; |
| Gene ID | 26995 |
| mRNA Refseq | NM_015679 |
| Protein Refseq | NP_056494 |
| MIM | 610727 |
| UniProt ID | O95900 |
| ◆ Recombinant Proteins | ||
| TRUB2-4704H | Recombinant Human TRUB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Trub2-6678M | Recombinant Mouse Trub2 Protein, Myc/DDK-tagged | +Inquiry |
| TRUB2-3441H | Recombinant Human TRUB2 protein, His-tagged | +Inquiry |
| TRUB2-6308R | Recombinant Rat TRUB2 Protein | +Inquiry |
| TRUB2-5965R | Recombinant Rat TRUB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRUB2-727HCL | Recombinant Human TRUB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRUB2 Products
Required fields are marked with *
My Review for All TRUB2 Products
Required fields are marked with *
