Recombinant Human TSC2, His-tagged
Cat.No. : | TSC2-31631TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1396-1725 of Human Tuberin Isoform 5 with N terminal His tag, MWt 38kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1396-1725 a.a. |
Description : | Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Conjugation : | HIS |
Tissue specificity : | Liver, brain, heart, lymphocytes, fibroblasts, biliary epithelium, pancreas, skeletal muscle, kidney, lung and placenta. |
Form : | Lyophilised:Reconstitute with 78 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFVFL QLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSY DTHKIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTGL GRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQ AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIVTPLDYECNLVSLQCRKDMEGL VDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNP TDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHP PSHSKAPAQTPAEPTPGYEVGQ |
Sequence Similarities : | Contains 1 Rap-GAP domain. |
Gene Name | TSC2 tuberous sclerosis 2 [ Homo sapiens ] |
Official Symbol | TSC2 |
Synonyms | TSC2; tuberous sclerosis 2; TSC4; tuberin; LAM; |
Gene ID | 7249 |
mRNA Refseq | NM_000548 |
Protein Refseq | NP_000539 |
MIM | 191092 |
Uniprot ID | P49815 |
Chromosome Location | 16p13.3 |
Pathway | AKT phosphorylates targets in the cytosol, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Energy dependent regulation of mTOR by LKB1-AMPK, organism-specific biosystem; |
Function | 14-3-3 protein binding; GTPase activator activity; protein binding; protein heterodimerization activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
TSC2-5967R | Recombinant Rat TSC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSC2-35H | Recombinant Human TSC2 protein, His-tagged | +Inquiry |
TSC2-31631TH | Recombinant Human TSC2, His-tagged | +Inquiry |
TSC2-6386Z | Recombinant Zebrafish TSC2 | +Inquiry |
TSC2-4633Z | Recombinant Zebrafish TSC2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSC2 Products
Required fields are marked with *
My Review for All TSC2 Products
Required fields are marked with *
0
Inquiry Basket