Recombinant Human TSG101, His-tagged

Cat.No. : TSG101-30750TH
Product Overview : Recombinant fragment, corresponding to amino acids 240-390 of Human TSG101 with N terminal His tag; Predicted MWt 19 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 240-390 a.a.
Description : The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Conjugation : HIS
Tissue specificity : Heart, brain, placenta, lung, liver, skeletal, kidney and pancreas.
Form : Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : WRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQ EVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEV IIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVID LDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Sequence Similarities : Belongs to the ubiquitin-conjugating enzyme family. UEV subfamily.Contains 1 SB (steadiness box) domain.Contains 1 UEV (ubiquitin E2 variant) domain.
Gene Name TSG101 tumor susceptibility gene 101 [ Homo sapiens ]
Official Symbol TSG101
Synonyms TSG101; tumor susceptibility gene 101; TSG10, tumor susceptibility gene 10; tumor susceptibility gene 101 protein; VPS23;
Gene ID 7251
mRNA Refseq NM_006292
Protein Refseq NP_006283
MIM 601387
Uniprot ID Q99816
Chromosome Location 11p15
Pathway ESCRT-I complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function DNA binding; calcium-dependent protein binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSG101 Products

Required fields are marked with *

My Review for All TSG101 Products

Required fields are marked with *

0
cart-icon
0
compare icon