Recombinant Human TSLP Protein
Cat.No. : | TSLP-258H |
Product Overview : | Recombinant Human TSLP Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Thymic stromal lymphopoietin (TSLP) is a hematopoietic cytokine produced in several tissues including the heart, liver and prostate. TSLP induces the release of T-cell attracting chemokines from monocytes, and regulates the maturation of myeloid and epidermal dendritic cells. TSLP signals through a heterodimeric receptor complex containing the TSLP receptor (TSLP-R/CRLF2) and IL-7R alpha chain. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 15.1 kDa (132 aa) |
AA Sequence : | MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | TSLP thymic stromal lymphopoietin [ Homo sapiens (human) ] |
Official Symbol | TSLP |
Synonyms | TSLP; thymic stromal lymphopoietin; |
Gene ID | 85480 |
mRNA Refseq | NM_033035 |
Protein Refseq | NP_149024 |
MIM | 607003 |
UniProt ID | Q969D9 |
◆ Recombinant Proteins | ||
Tslp-502M | Recombinant Mouse Tslp Protein, His-tagged | +Inquiry |
TSLP-255C | Recombinant Cynomolgus TSLP protein, His-tagged | +Inquiry |
TSLP-392H | Recombinant Human TSLP protein, His-Avi-tagged | +Inquiry |
Tslp-6810M | Recombinant Mouse Tslp protein, His-tagged | +Inquiry |
TSLP-052T | Active Recombinant Human TSLP Protein (132 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSLP Products
Required fields are marked with *
My Review for All TSLP Products
Required fields are marked with *
0
Inquiry Basket