Recombinant Human TSLP Protein

Cat.No. : TSLP-258H
Product Overview : Recombinant Human TSLP Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Thymic stromal lymphopoietin (TSLP) is a hematopoietic cytokine produced in several tissues including the heart, liver and prostate. TSLP induces the release of T-cell attracting chemokines from monocytes, and regulates the maturation of myeloid and epidermal dendritic cells. TSLP signals through a heterodimeric receptor complex containing the TSLP receptor (TSLP-R/CRLF2) and IL-7R alpha chain.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 15.1 kDa (132 aa)
AA Sequence : MYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name TSLP thymic stromal lymphopoietin [ Homo sapiens (human) ]
Official Symbol TSLP
Synonyms TSLP; thymic stromal lymphopoietin;
Gene ID 85480
mRNA Refseq NM_033035
Protein Refseq NP_149024
MIM 607003
UniProt ID Q969D9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSLP Products

Required fields are marked with *

My Review for All TSLP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon