Recombinant Human TSLP Protein, His-tagged
| Cat.No. : | TSLP-1390H |
| Product Overview : | Recombinant Human TSLP Protein (29-159aa) was expressed in Mammalian cells with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | His |
| Protein Length : | 29-159 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 18.9 kDa |
| AA Sequence : | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMF AMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | TSLP thymic stromal lymphopoietin [ Homo sapiens ] |
| Official Symbol | TSLP |
| Synonyms | TSLP; thymic stromal lymphopoietin |
| Gene ID | 85480 |
| mRNA Refseq | NM_033035 |
| Protein Refseq | NP_149024 |
| MIM | 607003 |
| UniProt ID | Q969D9 |
| ◆ Recombinant Proteins | ||
| Tslp-6810M | Recombinant Mouse Tslp protein, His-tagged | +Inquiry |
| Tslp-202M | Active Recombinant Mouse Thymic Stromal Lymphopoietin, His-tagged | +Inquiry |
| Tslp-468M | Recombinant Mouse TSLP protein(Met1-Glu140), His-tagged | +Inquiry |
| TSLP-5786W | Recombinant White-tufted-ear marmoset TSLP protein, His-SUMO-tagged | +Inquiry |
| TSLP-0775H | Active Recombinant Human TSLP protein, mFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSLP Products
Required fields are marked with *
My Review for All TSLP Products
Required fields are marked with *



