Recombinant Human TSLP Protein, His-tagged
Cat.No. : | TSLP-1390H |
Product Overview : | Recombinant Human TSLP Protein (29-159aa) was expressed in Mammalian cells with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | His |
Protein Length : | 29-159 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 18.9 kDa |
AA Sequence : | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMF AMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | TSLP thymic stromal lymphopoietin [ Homo sapiens ] |
Official Symbol | TSLP |
Synonyms | TSLP; thymic stromal lymphopoietin |
Gene ID | 85480 |
mRNA Refseq | NM_033035 |
Protein Refseq | NP_149024 |
MIM | 607003 |
UniProt ID | Q969D9 |
◆ Recombinant Proteins | ||
TSLP-6809H | Recombinant Human TSLP protein, His & T7-tagged | +Inquiry |
TSLP-0772R | Recombinant Rat TSLP protein, His-tagged | +Inquiry |
TSLP-6643H | Recombinant Human TSLP Protein (Tyr29-Gln159), C-His tagged | +Inquiry |
TSLP-312H | Recombinant Human TSLP protein | +Inquiry |
TSLP-0775H | Active Recombinant Human TSLP protein, mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSLP-1742MCL | Recombinant Mouse TSLP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSLP Products
Required fields are marked with *
My Review for All TSLP Products
Required fields are marked with *