Recombinant Human TSPAN2 protein
Cat.No. : | TSPAN2-3628H |
Product Overview : | Recombinant Human TSPAN2 protein(O60636)(112-188aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 112-188aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 8.8 kDa |
AA Sequence : | GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TSPAN2 tetraspanin 2 [ Homo sapiens ] |
Official Symbol | TSPAN2 |
Synonyms | TSPAN2; tetraspanin 2; tetraspanin-2; FLJ12082; TSN2; TSPAN 2; tetraspan 2; tetraspan NET-3; tetraspan TM4SF; new EST tetraspan 3; tetraspanin 2 isoform; NET3; TSPAN-2; |
Gene ID | 10100 |
mRNA Refseq | NM_005725 |
Protein Refseq | NP_005716 |
MIM | 613133 |
UniProt ID | O60636 |
◆ Recombinant Proteins | ||
TSPAN2-6326R | Recombinant Rat TSPAN2 Protein | +Inquiry |
TSPAN2-5982R | Recombinant Rat TSPAN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPAN2-3628H | Recombinant Human TSPAN2 protein | +Inquiry |
TSPAN2-2659Z | Recombinant Zebrafish TSPAN2 | +Inquiry |
RFL22311RF | Recombinant Full Length Rat Tetraspanin-2(Tspan2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN2-708HCL | Recombinant Human TSPAN2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSPAN2 Products
Required fields are marked with *
My Review for All TSPAN2 Products
Required fields are marked with *
0
Inquiry Basket