Recombinant Human TSPAN2 protein

Cat.No. : TSPAN2-3628H
Product Overview : Recombinant Human TSPAN2 protein(O60636)(112-188aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 112-188aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 8.8 kDa
AA Sequence : GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name TSPAN2 tetraspanin 2 [ Homo sapiens ]
Official Symbol TSPAN2
Synonyms TSPAN2; tetraspanin 2; tetraspanin-2; FLJ12082; TSN2; TSPAN 2; tetraspan 2; tetraspan NET-3; tetraspan TM4SF; new EST tetraspan 3; tetraspanin 2 isoform; NET3; TSPAN-2;
Gene ID 10100
mRNA Refseq NM_005725
Protein Refseq NP_005716
MIM 613133
UniProt ID O60636

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSPAN2 Products

Required fields are marked with *

My Review for All TSPAN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon