Recombinant Human TSPAN31 protein, His-tagged
| Cat.No. : | TSPAN31-3458H |
| Product Overview : | Recombinant Human TSPAN31 protein(91-180 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | November 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91-180 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | VISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TSPAN31 tetraspanin 31 [ Homo sapiens ] |
| Official Symbol | TSPAN31 |
| Synonyms | TSPAN31; tetraspanin 31; sarcoma amplified sequence , SAS; tetraspanin-31; tspan-31; transmembrane 4 protein; sarcoma amplified sequence; sarcoma-amplified sequence; SAS; |
| Gene ID | 6302 |
| mRNA Refseq | NM_005981 |
| Protein Refseq | NP_005972 |
| MIM | 181035 |
| UniProt ID | Q12999 |
| ◆ Recombinant Proteins | ||
| RFL24296MF | Recombinant Full Length Mouse Tetraspanin-31(Tspan31) Protein, His-Tagged | +Inquiry |
| TSPAN31-3458H | Recombinant Human TSPAN31 protein, His-tagged | +Inquiry |
| RFL36341SF | Recombinant Full Length Pig Tetraspanin-31(Tspan31) Protein, His-Tagged | +Inquiry |
| RFL6509DF | Recombinant Full Length Danio Rerio Tetraspanin-31(Tspan31) Protein, His-Tagged | +Inquiry |
| TSPAN31-5983R | Recombinant Rat TSPAN31 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSPAN31-780HCL | Recombinant Human TSPAN31 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPAN31 Products
Required fields are marked with *
My Review for All TSPAN31 Products
Required fields are marked with *
