Recombinant Human TSPAN4 protein, His-tagged

• Cat.No.: TSPAN4-3856H
• Product Overview: Recombinant Human TSPAN4 protein(96-212 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 96-212 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TSPAN4 tetraspanin 4 [ Homo sapiens ]
• Official Symbol: TSPAN4
• Synonyms: TSPAN4; tetraspanin 4; TM4SF7, transmembrane 4 superfamily member 7; tetraspanin-4; NAG 2; TETRASPAN; TSPAN 4; novel antigen 2; tetraspan TM4SF; transmembrane 4 superfamily member 7; NAG2; NAG-2; TM4SF7; TSPAN-4
• Gene ID: 7106
• mRNA Refseq: NM_001025234
• Protein Refseq: NP_001020405
• MIM: 602644
• UniProt ID: O14817