Recombinant Human TSPAN4 protein, GST-tagged
Cat.No. : | TSPAN4-5745H |
Product Overview : | Recombinant Human TSPAN4 protein(96-212 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 96-212 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | LEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCT |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TSPAN4 tetraspanin 4 [ Homo sapiens ] |
Official Symbol | TSPAN4 |
Synonyms | TSPAN4; tetraspanin 4; TM4SF7, transmembrane 4 superfamily member 7; tetraspanin-4; NAG 2; TETRASPAN; TSPAN 4; novel antigen 2; tetraspan TM4SF; transmembrane 4 superfamily member 7; NAG2; NAG-2; TM4SF7; TSPAN-4; |
mRNA Refseq | NM_001025234 |
Protein Refseq | NP_001020405 |
MIM | 602644 |
UniProt ID | O14817 |
Gene ID | 7106 |
◆ Recombinant Proteins | ||
TSPAN4-5745H | Recombinant Human TSPAN4 protein, GST-tagged | +Inquiry |
RFL23946HF | Recombinant Full Length Human Tetraspanin-4(Tspan4) Protein, His-Tagged | +Inquiry |
TSPAN4-3856H | Recombinant Human TSPAN4 protein, His-tagged | +Inquiry |
RFL24471PF | Recombinant Full Length Pongo Abelii Tetraspanin-4(Tspan4) Protein, His-Tagged | +Inquiry |
RFL9349MF | Recombinant Full Length Mouse Tetraspanin-4(Tspan4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN4-707HCL | Recombinant Human TSPAN4 293 Cell Lysate | +Inquiry |
TSPAN4-708HCL | Recombinant Human TSPAN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPAN4 Products
Required fields are marked with *
My Review for All TSPAN4 Products
Required fields are marked with *