Recombinant Full Length Pongo Pygmaeus Tetraspanin-7(Tspan7) Protein, His-Tagged
Cat.No. : | RFL32333PF |
Product Overview : | Recombinant Full Length Pongo pygmaeus Tetraspanin-7(TSPAN7) Protein (Q7YQK9) (1-244aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Pygmaeus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-244) |
Form : | Lyophilized powder |
AA Sequence : | METKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGT GTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYT DAMQTYDGKDDRSQAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQD LHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQ YEMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSPAN7 |
Synonyms | TSPAN7; TM4SF2; Tetraspanin-7; Tspan-7; Transmembrane 4 superfamily member 2; CD antigen CD231 |
UniProt ID | Q7YQK9 |
◆ Recombinant Proteins | ||
RFL26725HF | Recombinant Full Length Human Tetraspanin-7(Tspan7) Protein, His-Tagged | +Inquiry |
TSPAN7-571HF | Recombinant Full Length Human TSPAN7 Protein | +Inquiry |
TSPAN7-4818R | Recombinant Rhesus Macaque TSPAN7 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPAN7-195H | Recombinant Human TSPAN7, His-tagged | +Inquiry |
TSPAN7-12791Z | Recombinant Zebrafish TSPAN7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN7-861MCL | Recombinant Mouse TSPAN7 cell lysate | +Inquiry |
TSPAN7-813CCL | Recombinant Cynomolgus TSPAN7 cell lysate | +Inquiry |
TSPAN7-863HCL | Recombinant Human TSPAN7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSPAN7 Products
Required fields are marked with *
My Review for All TSPAN7 Products
Required fields are marked with *
0
Inquiry Basket