Recombinant Human TTN protein, His&Myc-tagged

Cat.No. : TTN-3629H
Product Overview : Recombinant Human TTN protein(Q8WZ42)(14257-14543aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 14257-14543aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.9 kDa
AA Sequence : RCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGG
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name TTN titin [ Homo sapiens ]
Official Symbol TTN
Synonyms TTN; titin; cardiomyopathy, dilated 1G (autosomal dominant) , CMD1G; CMH9; CMPD4; FLJ32040; LGMD2J; MYLK5; TMD; connectin; rhabdomyosarcoma antigen MU-RMS-40.14; CMD1G; EOMFC; HMERF; FLJ26020; FLJ26409; FLJ34413; FLJ39564; FLJ43066; DKFZp451N061;
Gene ID 7273
mRNA Refseq NM_001256850
Protein Refseq NP_001243779
MIM 188840
UniProt ID Q8WZ42

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TTN Products

Required fields are marked with *

My Review for All TTN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon