Recombinant Human TTN protein, His&Myc-tagged
| Cat.No. : | TTN-3629H |
| Product Overview : | Recombinant Human TTN protein(Q8WZ42)(14257-14543aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 14257-14543aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.9 kDa |
| AA Sequence : | RCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TTN titin [ Homo sapiens ] |
| Official Symbol | TTN |
| Synonyms | TTN; titin; cardiomyopathy, dilated 1G (autosomal dominant) , CMD1G; CMH9; CMPD4; FLJ32040; LGMD2J; MYLK5; TMD; connectin; rhabdomyosarcoma antigen MU-RMS-40.14; CMD1G; EOMFC; HMERF; FLJ26020; FLJ26409; FLJ34413; FLJ39564; FLJ43066; DKFZp451N061; |
| Gene ID | 7273 |
| mRNA Refseq | NM_001256850 |
| Protein Refseq | NP_001243779 |
| MIM | 188840 |
| UniProt ID | Q8WZ42 |
| ◆ Recombinant Proteins | ||
| TTN-3629H | Recombinant Human TTN protein, His&Myc-tagged | +Inquiry |
| TTN-25H | Recombinant Human TTN, GST-tagged | +Inquiry |
| TTN-705H | Recombinant Human Titin | +Inquiry |
| Ttn-507M | Recombinant Mouse Ttn Protein, His-tagged | +Inquiry |
| TTN-26H | Recombinant Human TTN, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTN Products
Required fields are marked with *
My Review for All TTN Products
Required fields are marked with *
