Recombinant Human TTN Protein, His-tagged
| Cat.No. : | TTN-1391H |
| Product Overview : | Recombinant Human TTN Protein (5398-5604aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 5398-5604 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 26.5 kDa |
| AA Sequence : | VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGF LTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLV RGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | TTN titin [ Homo sapiens] |
| Official Symbol | TTN |
| Synonyms | TTN; titin; TMD;CMH9; CMD1G; CMPD4; EOMFC; FLJ32040; FLJ26020; FLJ26409; FLJ34413; FLJ39564;FLJ43066; HMERF; MYLK5; LGMD2J; MPRM; DKFZp451N061; connectin; OTTHUMP00000233809;OTTHUMP00000233810; rhabdomyosarcoma antigen MU-RMS-40.14; cardiomyopathy,dilated 1G (autosomal dominant); EC 2.7.11.1 |
| Gene ID | 7273 |
| mRNA Refseq | NM_003319 |
| Protein Refseq | NP_003310 |
| MIM | 188840 |
| UniProt ID | E9PPD3 |
| ◆ Recombinant Proteins | ||
| TTN-27H | Recombinant Human TTN, GST-tagged | +Inquiry |
| TTN-25H | Recombinant Human TTN, GST-tagged | +Inquiry |
| TTN-3629H | Recombinant Human TTN protein, His&Myc-tagged | +Inquiry |
| TTN-26H | Recombinant Human TTN, GST-tagged | +Inquiry |
| TTN-1391H | Recombinant Human TTN Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTN Products
Required fields are marked with *
My Review for All TTN Products
Required fields are marked with *
