Recombinant Human TTR Protein, 21-147aa, F87M and L110M Mutation, N-His tagged
Cat.No. : | TTR-03H |
Product Overview : | Recombinant Human TTR Protein (21-147aa, F87M and L110M Mutation) with N-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-147aa |
Description : | This gene encodes one of the three prealbumins, which include alpha-1-antitrypsin, transthyretin and orosomucoid. The encoded protein, transthyretin, is a homo-tetrameric carrier protein, which transports thyroid hormones in the plasma and cerebrospinal fluid. It is also involved in the transport of retinol (vitamin A) in the plasma by associating with retinol-binding protein. The protein may also be involved in other intracellular processes including proteolysis, nerve regeneration, autophagy and glucose homeostasis. Mutations in this gene are associated with amyloid deposition, predominantly affecting peripheral nerves or the heart, while a small percentage of the gene mutations are non-amyloidogenic. The mutations are implicated in the etiology of several diseases, including amyloidotic polyneuropathy, euthyroid hyperthyroxinaemia, amyloidotic vitreous opacities, cardiomyopathy, oculoleptomeningeal amyloidosis, meningocerebrovascular amyloidosis and carpal tunnel syndrome. |
Form : | Liquid |
Molecular Mass : | Theoretical molecular weight: ~ 16 kDa |
AA Sequence : | MHHHHHHDDDDKGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIAAMLSPYSYSTTAVVTNPKE* |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Storage Buffer : | In 140 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4 , pH 8.0. |
Gene Name | TTR transthyretin [ Homo sapiens (human) ] |
Official Symbol | TTR |
Synonyms | TTR; transthyretin; PALB, prealbumin, amyloidosis type I; HsT2651; ATTR; carpal tunnel syndrome 1; thyroxine-binding prealbumin; prealbumin, amyloidosis type I; CTS; CTS1; PALB; TBPA |
Gene ID | 7276 |
mRNA Refseq | NM_000371 |
Protein Refseq | NP_000362 |
MIM | 176300 |
UniProt ID | P02766 |
◆ Recombinant Proteins | ||
TTR-6215H | Recombinant Human TTR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ttr-3630M | Recombinant Mouse Ttr protein, His-SUMO-tagged | +Inquiry |
TTR-728H | Recombinant Human TTR protein, His-tagged | +Inquiry |
TTR-01H | Recombinant Cynomolgus TTR Protein, His-tagged | +Inquiry |
Ttr-3631M | Recombinant Mouse Ttr protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
TTR-141S | Native Sheep prealbumin | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *
0
Inquiry Basket