Recombinant Human TTR protein(31-130 aa), C-His-tagged

Cat.No. : TTR-2530H
Product Overview : Recombinant Human TTR protein(P02766)(31-130 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-130 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 13.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL
Gene Name TTR transthyretin [ Homo sapiens ]
Official Symbol TTR
Synonyms TTR; transthyretin; PALB, prealbumin, amyloidosis type I; HsT2651; ATTR; carpal tunnel syndrome 1; thyroxine-binding prealbumin; prealbumin, amyloidosis type I; CTS; CTS1; PALB; TBPA;
Gene ID 7276
mRNA Refseq NM_000371
Protein Refseq NP_000362
MIM 176300
UniProt ID P02766

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TTR Products

Required fields are marked with *

My Review for All TTR Products

Required fields are marked with *

0
cart-icon