Recombinant Human TTR protein(31-130 aa), C-His-tagged
Cat.No. : | TTR-2530H |
Product Overview : | Recombinant Human TTR protein(P02766)(31-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-130 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 13.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL |
Gene Name | TTR transthyretin [ Homo sapiens ] |
Official Symbol | TTR |
Synonyms | TTR; transthyretin; PALB, prealbumin, amyloidosis type I; HsT2651; ATTR; carpal tunnel syndrome 1; thyroxine-binding prealbumin; prealbumin, amyloidosis type I; CTS; CTS1; PALB; TBPA; |
Gene ID | 7276 |
mRNA Refseq | NM_000371 |
Protein Refseq | NP_000362 |
MIM | 176300 |
UniProt ID | P02766 |
◆ Recombinant Proteins | ||
Ttr-1392M | Recombinant Mouse Ttr Protein | +Inquiry |
TTR-802C | Recombinant Cynomolgus Monkey TTR Protein, His (Fc)-Avi-tagged | +Inquiry |
TTR-128H | Recombinant Human TTR Protein, His-tagged | +Inquiry |
TTR-1284H | Recombinant Full Length Human TTR protein(Met1-Glu147), His-tagged | +Inquiry |
TTR-1837H | Recombinant Human Transthyretin | +Inquiry |
◆ Native Proteins | ||
TTR-31108TH | Native Human TTR | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *