Recombinant Human TTR protein(31-130 aa), C-His-tagged

• Cat.No.: TTR-2530H
• Product Overview: Recombinant Human TTR protein(P02766)(31-130 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 31-130 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 13.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL

Gene Information

• Gene Name: TTR transthyretin [ Homo sapiens ]
• Official Symbol: TTR
• Synonyms: TTR; transthyretin; PALB, prealbumin, amyloidosis type I; HsT2651; ATTR; carpal tunnel syndrome 1; thyroxine-binding prealbumin; prealbumin, amyloidosis type I; CTS; CTS1; PALB; TBPA
• Gene ID: 7276
• mRNA Refseq: NM_000371
• Protein Refseq: NP_000362
• MIM: 176300
• UniProt ID: P02766