Recombinant Human TTR protein(31-130 aa), C-His-tagged
| Cat.No. : | TTR-2530H |
| Product Overview : | Recombinant Human TTR protein(P02766)(31-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-130 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 13.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL |
| Gene Name | TTR transthyretin [ Homo sapiens ] |
| Official Symbol | TTR |
| Synonyms | TTR; transthyretin; PALB, prealbumin, amyloidosis type I; HsT2651; ATTR; carpal tunnel syndrome 1; thyroxine-binding prealbumin; prealbumin, amyloidosis type I; CTS; CTS1; PALB; TBPA; |
| Gene ID | 7276 |
| mRNA Refseq | NM_000371 |
| Protein Refseq | NP_000362 |
| MIM | 176300 |
| UniProt ID | P02766 |
| ◆ Recombinant Proteins | ||
| Ttr-6725M | Recombinant Mouse Ttr Protein, Myc/DDK-tagged | +Inquiry |
| TTR-3633C | Recombinant Cynomolgus monkey TTR protein, His-tagged | +Inquiry |
| TTR-6215H | Recombinant Human TTR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TTR-732R | Recombinant Rabbit TTR protein, His & T7-tagged | +Inquiry |
| Ttr-1392M | Recombinant Mouse Ttr Protein | +Inquiry |
| ◆ Native Proteins | ||
| TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
| TTR-706H | Native Human Transthyretin | +Inquiry |
| TTR-131H | Native Human Prealbumin protein | +Inquiry |
| TTR-31108TH | Native Human TTR | +Inquiry |
| TTR-254H | Native Human Prealbumin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *
