Recombinant Human TTR Protein, His-tagged
Cat.No. : | TTR-129H |
Product Overview : | Recombinant Human TTR Protein, fused to His-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes one of the three prealbumins, which include alpha-1-antitrypsin, transthyretin and orosomucoid. The encoded protein, transthyretin, is a homo-tetrameric carrier protein, which transports thyroid hormones in the plasma and cerebrospinal fluid. It is also involved in the transport of retinol (vitamin A) in the plasma by associating with retinol-binding protein. The protein may also be involved in other intracellular processes including proteolysis, nerve regeneration, autophagy and glucose homeostasis. Mutations in this gene are associated with amyloid deposition, predominantly affecting peripheral nerves or the heart, while a small percentage of the gene mutations are non-amyloidogenic. The mutations are implicated in the etiology of several diseases, including amyloidotic polyneuropathy, euthyroid hyperthyroxinaemia, amyloidotic vitreous opacities, cardiomyopathy, oculoleptomeningeal amyloidosis, meningocerebrovascular amyloidosis and carpal tunnel syndrome. |
Form : | Liquid. In 140 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4 , pH 8.0. |
Molecular Mass : | ~16 kDa |
AA Sequence : | MHHHHHHDDDDKGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPMHEHAEVVFTANDSGPRRYTIA AMLSPYSYSTTAVVTNPKE* |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20-80 centigrade. Avoid freeze/thaw cycles. |
Gene Name | TTR transthyretin [ Homo sapiens (human) ] |
Official Symbol | TTR |
Synonyms | CTS; TTN; ATTR; CTS1; PALB; TBPA; HEL111; HsT2651 |
Gene ID | 7276 |
mRNA Refseq | NM_000371 |
Protein Refseq | NP_000362 |
MIM | 176300 |
UniProt ID | P02766 |
◆ Recombinant Proteins | ||
TTR-2922H | Recombinant Human TTR Protein, MYC/DDK-tagged | +Inquiry |
TTR-802C | Recombinant Cynomolgus Monkey TTR Protein, His (Fc)-Avi-tagged | +Inquiry |
TTR-17603M | Recombinant Mouse TTR Protein | +Inquiry |
TTR-1220HFL | Recombinant Full Length Human TTR Protein, C-Flag-tagged | +Inquiry |
Ttr-1392M | Recombinant Mouse Ttr Protein | +Inquiry |
◆ Native Proteins | ||
TTR-155B | Native Bovine Prealbumin protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTR-2149HCL | Recombinant Human TTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTR Products
Required fields are marked with *
My Review for All TTR Products
Required fields are marked with *