Recombinant Human TUBB protein(11-440 aa), C-His-tagged
Cat.No. : | TUBB-2585H |
Product Overview : | Recombinant Human TUBB protein(P07437)(11-440 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-440 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEE |
Gene Name | TUBB tubulin, beta class I [ Homo sapiens ] |
Official Symbol | TUBB |
Synonyms | TUBB; tubulin, beta class I; tubulin, beta , tubulin, beta polypeptide; tubulin beta chain; beta1 tubulin; class I beta tubulin; M40; MGC16435; OK/SW cl.56; Tubb5; beta1-tubulin; beta 5-tubulin; beta-4 tubulin; beta Ib tubulin; class I beta-tubulin; tubulin beta-1 chain; tubulin beta-5 chain; tubulin beta polypeptide; tubulin, beta polypeptide; TUBB1; TUBB5; OK/SW-cl.56; MGC117247; |
Gene ID | 203068 |
mRNA Refseq | NM_178014 |
Protein Refseq | NP_821133 |
MIM | 191130 |
UniProt ID | P07437 |
◆ Recombinant Proteins | ||
TUBB-5389R | Recombinant Rhesus macaque TUBB protein, Avi-tagged, Biotinylated | +Inquiry |
TUBB-6867C | Recombinant Chicken TUBB | +Inquiry |
TUBB-2275H | Recombinant Human TUBB Protein, His (Fc)-Avi-tagged | +Inquiry |
TUBB-100HFL | Recombinant Full Length Human TUBB Protein, C-Flag-tagged | +Inquiry |
TUBB-5387R | Recombinant Rhesus macaque TUBB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB-653HCL | Recombinant Human TUBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBB Products
Required fields are marked with *
My Review for All TUBB Products
Required fields are marked with *