Recombinant Human TUBB4A Protein, His-tagged
| Cat.No. : | TUBB4A-564H |
| Product Overview : | Recombinant Human TUBB4A fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes a member of the beta tubulin family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene cause hypomyelinating leukodystrophy-6 and autosomal dominant torsion dystonia-4. Alternate splicing results in multiple transcript variants encoding different isoforms. A pseudogene of this gene is found on chromosome X. |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : | 51.7kD |
| AA Sequence : | MNHKVHHHHHHMREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPG |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | TUBB4A tubulin, beta 4A class IVa [ Homo sapiens ] |
| Official Symbol | TUBB4A |
| Synonyms | TUBB4A; tubulin, beta 4A class IVa; TUBB4, tubulin, beta 4 , tubulin, beta 4 class IVa; tubulin beta-4A chain; beta 5; class IVa beta tubulin; tubulin 5 beta; tubulin, beta, 5; tubulin beta-4 chain; class IVa beta-tubulin; tubulin, beta 4 class IVa; TUBB4; TUBB5; beta-5; |
| Gene ID | 10382 |
| mRNA Refseq | NM_006087 |
| Protein Refseq | NP_006078 |
| MIM | 602662 |
| UniProt ID | P04350 |
| ◆ Recombinant Proteins | ||
| TUBB4A-807C | Recombinant Cynomolgus Monkey TUBB4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUBB4A-17619M | Recombinant Mouse TUBB4A Protein | +Inquiry |
| TUBB4A-2278H | Recombinant Human TUBB4A Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUBB4A-564H | Recombinant Human TUBB4A Protein, His-tagged | +Inquiry |
| TUBB4A-1906H | Recombinant Human TUBB4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUBB4A-647HCL | Recombinant Human TUBB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBB4A Products
Required fields are marked with *
My Review for All TUBB4A Products
Required fields are marked with *



