Recombinant Human TUBB4A Protein, His-tagged

Cat.No. : TUBB4A-564H
Product Overview : Recombinant Human TUBB4A fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a member of the beta tubulin family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene cause hypomyelinating leukodystrophy-6 and autosomal dominant torsion dystonia-4. Alternate splicing results in multiple transcript variants encoding different isoforms. A pseudogene of this gene is found on chromosome X.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 51.7kD
AA Sequence : MNHKVHHHHHHMREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPG
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name TUBB4A tubulin, beta 4A class IVa [ Homo sapiens ]
Official Symbol TUBB4A
Synonyms TUBB4A; tubulin, beta 4A class IVa; TUBB4, tubulin, beta 4 , tubulin, beta 4 class IVa; tubulin beta-4A chain; beta 5; class IVa beta tubulin; tubulin 5 beta; tubulin, beta, 5; tubulin beta-4 chain; class IVa beta-tubulin; tubulin, beta 4 class IVa; TUBB4; TUBB5; beta-5;
Gene ID 10382
mRNA Refseq NM_006087
Protein Refseq NP_006078
MIM 602662
UniProt ID P04350

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TUBB4A Products

Required fields are marked with *

My Review for All TUBB4A Products

Required fields are marked with *

0
cart-icon