Recombinant Human TUBD1 protein, His-tagged
Cat.No. : | TUBD1-2744H |
Product Overview : | Recombinant Human TUBD1 protein(24 - 134 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24 - 134 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LSDSHSSQGLCSMRENEAYQASCKERFFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TUBD1 tubulin, delta 1 [ Homo sapiens ] |
Official Symbol | TUBD1 |
Synonyms | TUBD1; tubulin, delta 1; tubulin delta chain; FLJ12709; TUBD; delta-tubulin; |
Gene ID | 51174 |
mRNA Refseq | NM_001193609 |
Protein Refseq | NP_001180538 |
MIM | 607344 |
UniProt ID | Q9UJT1 |
◆ Recombinant Proteins | ||
TUBD1-325Z | Recombinant Zebrafish TUBD1 | +Inquiry |
TUBD1-808C | Recombinant Cynomolgus Monkey TUBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tubd1-1308M | Recombinant Mouse Tubd1 protein, His & T7-tagged | +Inquiry |
TUBD1-1065C | Recombinant Cynomolgus TUBD1 Protein, His-tagged | +Inquiry |
TUBD1-2744H | Recombinant Human TUBD1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBD1 Products
Required fields are marked with *
My Review for All TUBD1 Products
Required fields are marked with *
0
Inquiry Basket