Recombinant Human TUBG2 protein, His-tagged
Cat.No. : | TUBG2-3280H |
Product Overview : | Recombinant Human TUBG2 protein(358-451 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 358-451 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TUBG2 tubulin, gamma 2 [ Homo sapiens ] |
Official Symbol | TUBG2 |
Synonyms | TUBG2; tubulin, gamma 2; tubulin gamma-2 chain; gamma-2-tubulin; MGC131994; |
Gene ID | 27175 |
mRNA Refseq | NM_016437 |
Protein Refseq | NP_057521 |
MIM | 605785 |
UniProt ID | Q9NRH3 |
◆ Recombinant Proteins | ||
TUBG2-732H | Recombinant Human TUBG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TUBG2-3280H | Recombinant Human TUBG2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBG2-643HCL | Recombinant Human TUBG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBG2 Products
Required fields are marked with *
My Review for All TUBG2 Products
Required fields are marked with *
0
Inquiry Basket