Recombinant Human TUFM, His-tagged
Cat.No. : | TUFM-31633TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 211-452 of Human TUFM with an N terminal His tag. Predicted MWt: 28 kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 211-452 a.a. |
Description : | This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 69 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVP ARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGD ECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALV RGLKREDLRRGLVMVKPGSIKPHQKVEAQVYILSKEEGGR HKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDL KFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM TEEEKNIKWG |
Gene Name | TUFM Tu translation elongation factor, mitochondrial [ Homo sapiens ] |
Official Symbol | TUFM |
Synonyms | TUFM; Tu translation elongation factor, mitochondrial; elongation factor Tu, mitochondrial; EF TuMT; EFTu; EFTU; |
Gene ID | 7284 |
mRNA Refseq | NM_003321 |
Protein Refseq | NP_003312 |
MIM | 602389 |
Uniprot ID | P49411 |
Chromosome Location | 16p11.2 |
Function | GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity; |
◆ Recombinant Proteins | ||
TUFM-1189H | Recombinant Human TUFM Protein (46-290 aa), His-tagged | +Inquiry |
TUFM-6022R | Recombinant Rat TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
TUFM-310H | Recombinant Human TUFM, GST-tagged | +Inquiry |
TUFM-4841R | Recombinant Rhesus Macaque TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
TUFM-2764H | Recombinant Human TUFM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUFM Products
Required fields are marked with *
My Review for All TUFM Products
Required fields are marked with *