Recombinant Human TUFM, GST-tagged

Cat.No. : TUFM-310H
Product Overview : Recombinant Human TUFM(40 a.a. - 455 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17.
Molecular Mass : 71.5 kDa
AA Sequence : PLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAATTKILAEGGGAKFKKYEEIDNAPEERARGITINAA HVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAV QDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLP VEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRR GLVMVKPGSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILR QPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TUFM Tu translation elongation factor, mitochondrial [ Homo sapiens ]
Official Symbol TUFM
Synonyms TUFM; Tu translation elongation factor, mitochondrial; elongation factor Tu, mitochondrial; EF TuMT; EFTu; EFTU
Gene ID 7284
mRNA Refseq NM_003321
Protein Refseq NP_003312
MIM 602389
UniProt ID P49411
Chromosome Location 16p11.2
Function GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TUFM Products

Required fields are marked with *

My Review for All TUFM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon