Recombinant Human TUFM, GST-tagged
| Cat.No. : | TUFM-310H |
| Product Overview : | Recombinant Human TUFM(40 a.a. - 455 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. |
| Molecular Mass : | 71.5 kDa |
| AA Sequence : | PLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAATTKILAEGGGAKFKKYEEIDNAPEERARGITINAA HVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAV QDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLP VEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRR GLVMVKPGSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILR QPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TUFM Tu translation elongation factor, mitochondrial [ Homo sapiens ] |
| Official Symbol | TUFM |
| Synonyms | TUFM; Tu translation elongation factor, mitochondrial; elongation factor Tu, mitochondrial; EF TuMT; EFTu; EFTU |
| Gene ID | 7284 |
| mRNA Refseq | NM_003321 |
| Protein Refseq | NP_003312 |
| MIM | 602389 |
| UniProt ID | P49411 |
| Chromosome Location | 16p11.2 |
| Function | GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity |
| ◆ Recombinant Proteins | ||
| TUFM-845H | Recombinant Human TUFM Protein (44-452 aa), His-SUMO-tagged | +Inquiry |
| TUFM-6022R | Recombinant Rat TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUFM-4841R | Recombinant Rhesus Macaque TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUFM-2764H | Recombinant Human TUFM protein, His-tagged | +Inquiry |
| TUFM-1550H | Recombinant Human TUFM Protein (44-452 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUFM Products
Required fields are marked with *
My Review for All TUFM Products
Required fields are marked with *
