Recombinant Human TUFM, GST-tagged

• Cat.No.: TUFM-310H
• Product Overview: Recombinant Human TUFM(40 a.a. - 455 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17.
• Molecular Mass: 71.5 kDa
• AA Sequence: PLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAATTKILAEGGGAKFKKYEEIDNAPEERARGITINAA HVEYSTAARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAV QDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLLP VEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRR GLVMVKPGSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILR QPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TUFM Tu translation elongation factor, mitochondrial [ Homo sapiens ]
• Official Symbol: TUFM
• Synonyms: TUFM; Tu translation elongation factor, mitochondrial; elongation factor Tu, mitochondrial; EF TuMT; EFTu; EFTU
• Gene ID: 7284
• mRNA Refseq: NM_003321
• Protein Refseq: NP_003312
• MIM: 602389
• UniProt ID: P49411
• Chromosome Location: 16p11.2
• Function: GTP binding; GTPase activity; nucleotide binding; translation elongation factor activity