Recombinant Human TUFM protein, His-tagged
Cat.No. : | TUFM-3636H |
Product Overview : | Recombinant Human TUFM protein(P49411)(44-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 44-452aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49 kDa |
AA Sequence : | MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TUFM Tu translation elongation factor, mitochondrial [ Homo sapiens ] |
Official Symbol | TUFM |
Synonyms | TUFM; Tu translation elongation factor, mitochondrial; elongation factor Tu, mitochondrial; EF TuMT; EFTu; EFTU; EF-Tu; P43; COXPD4; EF-TuMT; |
Gene ID | 7284 |
mRNA Refseq | NM_003321 |
Protein Refseq | NP_003312 |
MIM | 602389 |
UniProt ID | P49411 |
◆ Recombinant Proteins | ||
TUFM-5028R | Recombinant Rhesus monkey TUFM Protein, His-tagged | +Inquiry |
TUFM-3636H | Recombinant Human TUFM protein, His-tagged | +Inquiry |
TUFM-17631M | Recombinant Mouse TUFM Protein | +Inquiry |
TUFM-31633TH | Recombinant Human TUFM, His-tagged | +Inquiry |
TUFM-310H | Recombinant Human TUFM, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUFM Products
Required fields are marked with *
My Review for All TUFM Products
Required fields are marked with *
0
Inquiry Basket