Recombinant Human TUFM protein, His-tagged
| Cat.No. : | TUFM-3636H |
| Product Overview : | Recombinant Human TUFM protein(P49411)(44-452aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 44-452aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 49 kDa |
| AA Sequence : | MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | TUFM Tu translation elongation factor, mitochondrial [ Homo sapiens ] |
| Official Symbol | TUFM |
| Synonyms | TUFM; Tu translation elongation factor, mitochondrial; elongation factor Tu, mitochondrial; EF TuMT; EFTu; EFTU; EF-Tu; P43; COXPD4; EF-TuMT; |
| Gene ID | 7284 |
| mRNA Refseq | NM_003321 |
| Protein Refseq | NP_003312 |
| MIM | 602389 |
| UniProt ID | P49411 |
| ◆ Recombinant Proteins | ||
| TUFM-2764H | Recombinant Human TUFM protein, His-tagged | +Inquiry |
| TUFM-3636H | Recombinant Human TUFM protein, His-tagged | +Inquiry |
| TUFM-9768M | Recombinant Mouse TUFM Protein, His (Fc)-Avi-tagged | +Inquiry |
| TUFM-17631M | Recombinant Mouse TUFM Protein | +Inquiry |
| TUFM-1189H | Recombinant Human TUFM Protein (46-290 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUFM Products
Required fields are marked with *
My Review for All TUFM Products
Required fields are marked with *



