Recombinant Human TULP1 protein(131-310 aa), C-His-tagged
Cat.No. : | TULP1-2453H |
Product Overview : | Recombinant Human TULP1 protein(O00294)(131-310 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 131-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EAEEKKEKILLPPKKPLREKSSADLKERRAKAQGPRGDLGSPDPPPKPLRVRNKEAPAGEGTKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAPQGRTVRCRLT |
Gene Name | TULP1 tubby like protein 1 [ Homo sapiens ] |
Official Symbol | TULP1 |
Synonyms | TULP1; tub; RP14; tubby-related protein 1; TUBL1; LCA15; |
Gene ID | 7287 |
mRNA Refseq | NM_003322 |
Protein Refseq | NP_003313 |
MIM | 602280 |
UniProt ID | O00294 |
◆ Recombinant Proteins | ||
TULP1-9770M | Recombinant Mouse TULP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TULP1-17633M | Recombinant Mouse TULP1 Protein | +Inquiry |
TULP1-2453H | Recombinant Human TULP1 protein(131-310 aa), C-His-tagged | +Inquiry |
TULP1-6183C | Recombinant Chicken TULP1 | +Inquiry |
TULP1-1424H | Recombinant Human TULP1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TULP1-712HCL | Recombinant Human TULP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TULP1 Products
Required fields are marked with *
My Review for All TULP1 Products
Required fields are marked with *
0
Inquiry Basket