Recombinant Human TULP1 protein(131-310 aa), C-His-tagged

Cat.No. : TULP1-2453H
Product Overview : Recombinant Human TULP1 protein(O00294)(131-310 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 131-310 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EAEEKKEKILLPPKKPLREKSSADLKERRAKAQGPRGDLGSPDPPPKPLRVRNKEAPAGEGTKMRKTKKKGSGEADKDPSGSPASARKSPAAMFLVGEGSPDKKALKKKGTPKGARKEEEEEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAPQGRTVRCRLT
Gene Name TULP1 tubby like protein 1 [ Homo sapiens ]
Official Symbol TULP1
Synonyms TULP1; tub; RP14; tubby-related protein 1; TUBL1; LCA15;
Gene ID 7287
mRNA Refseq NM_003322
Protein Refseq NP_003313
MIM 602280
UniProt ID O00294

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TULP1 Products

Required fields are marked with *

My Review for All TULP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon