Recombinant Human tumor protein p53 binding protein 1 Protein, His tagged

Cat.No. : TP53BP1-001H
Product Overview : Recombinant Human TP53BP1 Protein (1614-1972aa) with His tag was expressed in CHO.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : His
Protein Length : 1614-1972aa
Description : This gene encodes a protein that functions in the DNA double-strand break repair pathway choice, promoting non-homologous end joining (NHEJ) pathways, and limiting homologous recombination. This protein plays multiple roles in the DNA damage response, including promoting checkpoint signaling following DNA damage, acting as a scaffold for recruitment of DNA damage response proteins to damaged chromatin, and promoting NHEJ pathways by limiting end resection following a double-strand break. These roles are also important during V(D)J recombination, class switch recombination and at unprotected telomeres. Alternative splicing results in multiple transcript variants encoding different isoforms.
Tag : C-His
Molecular Mass : 40.66 kDa
AA Sequence : AADISLDNLVEGKRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSHHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 70% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4
Concentration : 1.0 mg/mL by BCA
Gene Name TP53BP1 tumor protein p53 binding protein 1 [ Homo sapiens (human) ]
Official Symbol TP53BP1
Synonyms TP53BP1; tumor protein p53 binding protein 1; tumor protein p53 binding protein, 1; tumor suppressor p53-binding protein 1; 53BP1; p202; p53BP1; p53-binding protein 1; tumor protein 53-binding protein, 1; tumor protein p53-binding protein, 1; FLJ41424; MGC138366
Gene ID 7158
mRNA Refseq NM_001141979
Protein Refseq NP_001135451
MIM 605230
UniProt ID Q12888

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TP53BP1 Products

Required fields are marked with *

My Review for All TP53BP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon