Recombinant Human tumor protein p53 binding protein 1 Protein, His tagged

• Cat.No.: TP53BP1-001H
• Product Overview: Recombinant Human TP53BP1 Protein (1614-1972aa) with His tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: His
• Protein Length: 1614-1972aa
• Description: This gene encodes a protein that functions in the DNA double-strand break repair pathway choice, promoting non-homologous end joining (NHEJ) pathways, and limiting homologous recombination. This protein plays multiple roles in the DNA damage response, including promoting checkpoint signaling following DNA damage, acting as a scaffold for recruitment of DNA damage response proteins to damaged chromatin, and promoting NHEJ pathways by limiting end resection following a double-strand break. These roles are also important during V(D)J recombination, class switch recombination and at unprotected telomeres. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Tag: C-His
• Molecular Mass: 40.66 kDa
• AA Sequence: AADISLDNLVEGKRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSHHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 70% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4
• Concentration: 1.0 mg/mL by BCA

Gene Information

• Gene Name: TP53BP1 tumor protein p53 binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: TP53BP1
• Synonyms: TP53BP1; tumor protein p53 binding protein 1; tumor protein p53 binding protein, 1; tumor suppressor p53-binding protein 1; 53BP1; p202; p53BP1; p53-binding protein 1; tumor protein 53-binding protein, 1; tumor protein p53-binding protein, 1; FLJ41424; MGC138366
• Gene ID: 7158
• mRNA Refseq: NM_001141979
• Protein Refseq: NP_001135451
• MIM: 605230
• UniProt ID: Q12888