Recombinant Human TUSC2 protein, GST-tagged
Cat.No. : | TUSC2-3637H |
Product Overview : | Recombinant Human TUSC2 protein(O75896)(1-110aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-110aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TUSC2 tumor suppressor candidate 2 [ Homo sapiens ] |
Official Symbol | TUSC2 |
Synonyms | TUSC2; tumor suppressor candidate 2; PDAP2, PDGFA associated protein 2; C3orf11; FUS1; PAP; fus-1 protein; fusion 1 protein; PDGFA associated protein 2; PDGFA-associated protein 2; PDAP2; |
Gene ID | 11334 |
mRNA Refseq | NM_007275 |
Protein Refseq | NP_009206 |
MIM | 607052 |
UniProt ID | O75896 |
◆ Recombinant Proteins | ||
TUSC2-3637H | Recombinant Human TUSC2 protein, GST-tagged | +Inquiry |
TUSC2-5031R | Recombinant Rhesus monkey TUSC2 Protein, His-tagged | +Inquiry |
TUSC2-4844R | Recombinant Rhesus Macaque TUSC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TUSC2-2296H | Recombinant Human TUSC2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUSC2-636HCL | Recombinant Human TUSC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUSC2 Products
Required fields are marked with *
My Review for All TUSC2 Products
Required fields are marked with *
0
Inquiry Basket