Recombinant Human TWIST2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TWIST2-3420H
Product Overview : TWIST2 MS Standard C13 and N15-labeled recombinant protein (NP_476527) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found.
Molecular Mass : 18.1 kDa
AA Sequence : MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TWIST2 twist family bHLH transcription factor 2 [ Homo sapiens (human) ]
Official Symbol TWIST2
Synonyms TWIST2; twist homolog 2 (Drosophila); twist-related protein 2; bHLHa39; Dermo 1; DERMO1; dermis-expressed protein 1; twist-related bHLH protein Dermo1; class A basic helix-loop-helix protein 39; MGC117334;
Gene ID 117581
mRNA Refseq NM_057179
Protein Refseq NP_476527
MIM 607556
UniProt ID Q8WVJ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TWIST2 Products

Required fields are marked with *

My Review for All TWIST2 Products

Required fields are marked with *

0
cart-icon
0
compare icon