Recombinant Human TXLNA, His-tagged

Cat.No. : TXLNA-27H
Product Overview : Recombinant Human α-Taxilin/TXLNA is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ala546) of Human TXLNA fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-546 a.a.
Description : α-Taxilin belongs to the taxilin family. α-Taxilin exists in almost all tissues, with higher expression levels observed in the heart, kidney, liver, and pancreas. α-Taxilin binds to the C-terminal coiled coil region of syntaxin family members STX1A, STX3A, and STX4A, but not when these proteins are complexed with SNAP25, VAMP2 or STXBP1, suggesting that it interacts with syntaxins that do not form the SNARE complex. It is shown that α-Taxilin plays multiple roles in the generation and maintenance of neurons through modulation of the NAC-mediated translational machinary and/or the syntaxin-mediated vesicle traffic in the soma. In addition, α-Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.
AA Sequence : MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQS GALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVN GEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNTLSTPEEKLAALCKK YAELLEEHRNSQKQMKLLQKKQSQLVQEKDHLCGEHSKAVLARSKLESLCRELQRHNRSLKEEGV QRAREEEEKRKEVTSHFQVTLNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDK VFKHKDLQQQLVDAKLQQAQEMLKEAEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALY TEKFEEFQNTLSKSSEVFTTFKQEMEKMTKKIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDK ELEGLQVKIQRLEKLCRALQTERNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTE APCYPGAPSTEASGQTGPQEPTSARAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name TXLNA taxilin alpha [ Homo sapiens ]
Official Symbol TXLNA
Synonyms TXLNA; taxilin alpha; alpha-taxilin; DKFZp451J0118; interleukin 14; IL14; TXLN; RP4-622L5.4; MGC118870; MGC118871;
Gene ID 200081
mRNA Refseq NM_175852
Protein Refseq NP_787048
MIM 608676
UniProt ID P40222
Chromosome Location 1p35
Pathway TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function cytokine activity; high molecular weight B cell growth factor receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXLNA Products

Required fields are marked with *

My Review for All TXLNA Products

Required fields are marked with *

0
cart-icon