Recombinant Human TXLNA, His-tagged
Cat.No. : | TXLNA-27H |
Product Overview : | Recombinant Human α-Taxilin/TXLNA is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Ala546) of Human TXLNA fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-546 a.a. |
Description : | α-Taxilin belongs to the taxilin family. α-Taxilin exists in almost all tissues, with higher expression levels observed in the heart, kidney, liver, and pancreas. α-Taxilin binds to the C-terminal coiled coil region of syntaxin family members STX1A, STX3A, and STX4A, but not when these proteins are complexed with SNAP25, VAMP2 or STXBP1, suggesting that it interacts with syntaxins that do not form the SNARE complex. It is shown that α-Taxilin plays multiple roles in the generation and maintenance of neurons through modulation of the NAC-mediated translational machinary and/or the syntaxin-mediated vesicle traffic in the soma. In addition, α-Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells. |
AA Sequence : | MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQS GALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVN GEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLNTLSTPEEKLAALCKK YAELLEEHRNSQKQMKLLQKKQSQLVQEKDHLCGEHSKAVLARSKLESLCRELQRHNRSLKEEGV QRAREEEEKRKEVTSHFQVTLNDIQLQMEQHNERNSKLRQENMELAERLKKLIEQYELREEHIDK VFKHKDLQQQLVDAKLQQAQEMLKEAEERHQREKDFLLKEAVESQRMCELMKQQETHLKQQLALY TEKFEEFQNTLSKSSEVFTTFKQEMEKMTKKIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDK ELEGLQVKIQRLEKLCRALQTERNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTE APCYPGAPSTEASGQTGPQEPTSARAVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | TXLNA taxilin alpha [ Homo sapiens ] |
Official Symbol | TXLNA |
Synonyms | TXLNA; taxilin alpha; alpha-taxilin; DKFZp451J0118; interleukin 14; IL14; TXLN; RP4-622L5.4; MGC118870; MGC118871; |
Gene ID | 200081 |
mRNA Refseq | NM_175852 |
Protein Refseq | NP_787048 |
MIM | 608676 |
UniProt ID | P40222 |
Chromosome Location | 1p35 |
Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | cytokine activity; high molecular weight B cell growth factor receptor binding; |
◆ Recombinant Proteins | ||
TXLNA-28H | Recombinant Human TXLNA Protein, Flag-tagged | +Inquiry |
TXLNA-3696H | Recombinant Human TXLNA Protein (Lys328-Glu531), His tagged | +Inquiry |
TXLNA-2281H | Recombinant Human TXLNA Protein, His (Fc)-Avi-tagged | +Inquiry |
TXLNA-3396H | Recombinant Human TXLNA, His-tagged | +Inquiry |
TXLNA-514H | Recombinant Human TXLNA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXLNA-629HCL | Recombinant Human TXLNA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXLNA Products
Required fields are marked with *
My Review for All TXLNA Products
Required fields are marked with *