Recombinant Human TXNDC17 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TXNDC17-4645H
Product Overview : TXNDC17 MS Standard C13 and N15-labeled recombinant protein (NP_116120) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TXNDC17 (Thioredoxin Domain Containing 17) is a Protein Coding gene. Diseases associated with TXNDC17 include Parametritis and Eiken Syndrome. Gene Ontology (GO) annotations related to this gene include electron transfer activity and protein-disulfide reductase activity.
Molecular Mass : 13.9 kDa
AA Sequence : MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TXNDC17 thioredoxin domain containing 17 [ Homo sapiens (human) ]
Official Symbol TXNDC17
Synonyms TXNDC17; thioredoxin domain containing 17; TRP14; TXNL5; thioredoxin domain-containing protein 17; 14 kDa thioredoxin-related protein; protein 42-9-9; testicular tissue protein Li 214; thioredoxin (Trx)-related protein, 14 kDa; thioredoxin-like 5; thioredoxin-like protein 5
Gene ID 84817
mRNA Refseq NM_032731
Protein Refseq NP_116120
MIM 616967
UniProt ID Q9BRA2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TXNDC17 Products

Required fields are marked with *

My Review for All TXNDC17 Products

Required fields are marked with *

0
cart-icon
0
compare icon