Recombinant Human TXNDC17 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TXNDC17-4645H |
| Product Overview : | TXNDC17 MS Standard C13 and N15-labeled recombinant protein (NP_116120) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TXNDC17 (Thioredoxin Domain Containing 17) is a Protein Coding gene. Diseases associated with TXNDC17 include Parametritis and Eiken Syndrome. Gene Ontology (GO) annotations related to this gene include electron transfer activity and protein-disulfide reductase activity. |
| Molecular Mass : | 13.9 kDa |
| AA Sequence : | MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TXNDC17 thioredoxin domain containing 17 [ Homo sapiens (human) ] |
| Official Symbol | TXNDC17 |
| Synonyms | TXNDC17; thioredoxin domain containing 17; TRP14; TXNL5; thioredoxin domain-containing protein 17; 14 kDa thioredoxin-related protein; protein 42-9-9; testicular tissue protein Li 214; thioredoxin (Trx)-related protein, 14 kDa; thioredoxin-like 5; thioredoxin-like protein 5 |
| Gene ID | 84817 |
| mRNA Refseq | NM_032731 |
| Protein Refseq | NP_116120 |
| MIM | 616967 |
| UniProt ID | Q9BRA2 |
| ◆ Recombinant Proteins | ||
| TXNDC17-4645H | Recombinant Human TXNDC17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TXNDC17-17658M | Recombinant Mouse TXNDC17 Protein | +Inquiry |
| TXNDC17-4851R | Recombinant Rhesus Macaque TXNDC17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Txndc17-6748M | Recombinant Mouse Txndc17 Protein, Myc/DDK-tagged | +Inquiry |
| TXNDC17-5038R | Recombinant Rhesus monkey TXNDC17 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNDC17-624HCL | Recombinant Human TXNDC17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC17 Products
Required fields are marked with *
My Review for All TXNDC17 Products
Required fields are marked with *
