Recombinant Human TXNDC9 protein, GST-tagged
| Cat.No. : | TXNDC9-1800H |
| Product Overview : | Recombinant Human TXNDC9 protein(1-226 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-226 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TXNDC9 thioredoxin domain containing 9 [ Homo sapiens ] |
| Official Symbol | TXNDC9 |
| Synonyms | TXNDC9; thioredoxin domain containing 9; thioredoxin domain-containing protein 9; APACD; protein 1-4; ATP binding protein associated with cell differentiation; ATP-binding protein associated with cell differentiation; PHLP3; |
| Gene ID | 10190 |
| mRNA Refseq | NM_005783 |
| Protein Refseq | NP_005774 |
| MIM | 612564 |
| UniProt ID | O14530 |
| ◆ Recombinant Proteins | ||
| TXNDC9-4400H | Recombinant Human TXNDC9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TXNDC9-17662M | Recombinant Mouse TXNDC9 Protein | +Inquiry |
| TXNDC9-4852R | Recombinant Rhesus Macaque TXNDC9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Txndc9-6749M | Recombinant Mouse Txndc9 Protein, Myc/DDK-tagged | +Inquiry |
| TXNDC9-1800H | Recombinant Human TXNDC9 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNDC9-621HCL | Recombinant Human TXNDC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC9 Products
Required fields are marked with *
My Review for All TXNDC9 Products
Required fields are marked with *



