Recombinant Human TXNDC9 protein, GST-tagged
Cat.No. : | TXNDC9-1800H |
Product Overview : | Recombinant Human TXNDC9 protein(1-226 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-226 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TXNDC9 thioredoxin domain containing 9 [ Homo sapiens ] |
Official Symbol | TXNDC9 |
Synonyms | TXNDC9; thioredoxin domain containing 9; thioredoxin domain-containing protein 9; APACD; protein 1-4; ATP binding protein associated with cell differentiation; ATP-binding protein associated with cell differentiation; PHLP3; |
Gene ID | 10190 |
mRNA Refseq | NM_005783 |
Protein Refseq | NP_005774 |
MIM | 612564 |
UniProt ID | O14530 |
◆ Recombinant Proteins | ||
TXNDC9-10380Z | Recombinant Zebrafish TXNDC9 | +Inquiry |
TXNDC9-1800H | Recombinant Human TXNDC9 protein, GST-tagged | +Inquiry |
TXNDC9-17662M | Recombinant Mouse TXNDC9 Protein | +Inquiry |
Txndc9-6749M | Recombinant Mouse Txndc9 Protein, Myc/DDK-tagged | +Inquiry |
TXNDC9-9789M | Recombinant Mouse TXNDC9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXNDC9-621HCL | Recombinant Human TXNDC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNDC9 Products
Required fields are marked with *
My Review for All TXNDC9 Products
Required fields are marked with *