Recombinant Human TXNL4B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TXNL4B-4893H
• Product Overview: TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_001135790) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TXNL4B (Thioredoxin Like 4B) is a Protein Coding gene. Diseases associated with TXNL4B include Anhaptoglobinemia and Epithelial-Stromal Tgfbi Dystrophy. An important paralog of this gene is TXNL4A.
• Molecular Mass: 17 kDa
• AA Sequence: MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TXNL4B thioredoxin-like 4B [ Homo sapiens (human) ]
• Official Symbol: TXNL4B
• Synonyms: TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511; Dim1-like protein
• Gene ID: 54957
• mRNA Refseq: NM_001142318
• Protein Refseq: NP_001135790
• MIM: 617722
• UniProt ID: Q9NX01