Recombinant Human TXNL4B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | TXNL4B-4893H |
| Product Overview : | TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_001135790) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | TXNL4B (Thioredoxin Like 4B) is a Protein Coding gene. Diseases associated with TXNL4B include Anhaptoglobinemia and Epithelial-Stromal Tgfbi Dystrophy. An important paralog of this gene is TXNL4A. |
| Molecular Mass : | 17 kDa |
| AA Sequence : | MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | TXNL4B thioredoxin-like 4B [ Homo sapiens (human) ] |
| Official Symbol | TXNL4B |
| Synonyms | TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511; Dim1-like protein; |
| Gene ID | 54957 |
| mRNA Refseq | NM_001142318 |
| Protein Refseq | NP_001135790 |
| MIM | 617722 |
| UniProt ID | Q9NX01 |
| ◆ Recombinant Proteins | ||
| TXNL4B-8423Z | Recombinant Zebrafish TXNL4B | +Inquiry |
| TXNL4B-31638TH | Recombinant Human TXNL4B, His-tagged | +Inquiry |
| TXNL4B-5043R | Recombinant Rhesus monkey TXNL4B Protein, His-tagged | +Inquiry |
| TXNL4B-3504H | Recombinant Human TXNL4B protein, GST-tagged | +Inquiry |
| TXNL4B-546H | Recombinant Human TXNL4B protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TXNL4B-617HCL | Recombinant Human TXNL4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TXNL4B Products
Required fields are marked with *
My Review for All TXNL4B Products
Required fields are marked with *
