Recombinant Human TYK2
| Cat.No. : | TYK2-31641TH |
| Product Overview : | Recombinant fragment of Human TYK2 with a proprietary tag: predicted molecular weight 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Description : | This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E. |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines. |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA |
| Sequence Similarities : | Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.Contains 1 FERM domain.Contains 1 protein kinase domain.Contains 1 SH2 domain. |
| Gene Name | TYK2 tyrosine kinase 2 [ Homo sapiens ] |
| Official Symbol | TYK2 |
| Synonyms | TYK2; tyrosine kinase 2; non-receptor tyrosine-protein kinase TYK2; JTK1; |
| Gene ID | 7297 |
| mRNA Refseq | NM_003331 |
| Protein Refseq | NP_003322 |
| MIM | 176941 |
| Uniprot ID | P29597 |
| Chromosome Location | 19p13.2 |
| Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
| Function | ATP binding; growth hormone receptor binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein tyrosine kinase activity; |
| ◆ Recombinant Proteins | ||
| Tyk2-7156M | Recombinant Mouse Tyk2 protein, His & T7-tagged | +Inquiry |
| TYK2-03H | Recombinant Human TYK2 Protein, Myc/DDK-tagged | +Inquiry |
| TYK2-01H | Recombinant Human TYK2 (JH2 domain, 575-869), N-FLAG-tagged | +Inquiry |
| TYK2-703H | Recombinant Human TYK2 protein, His-tagged | +Inquiry |
| TYK2-3508H | Recombinant Human TYK2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TYK2-1867HCL | Recombinant Human TYK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYK2 Products
Required fields are marked with *
My Review for All TYK2 Products
Required fields are marked with *
