Recombinant Human TYRP1 protein, His-tagged
Cat.No. : | TYRP1-3688H |
Product Overview : | Recombinant Human TYRP1 protein(91 - 186 aa), fused to His tag, was expressed in E. coli. |
Availability | July 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91 - 186 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TYRP1 tyrosinase-related protein 1 [ Homo sapiens ] |
Official Symbol | TYRP1 |
Synonyms | TYRP1; tyrosinase-related protein 1; CAS2, TYRP; 5,6-dihydroxyindole-2-carboxylic acid oxidase; b PROTEIN; CATB; GP75; TRP; TRP1; TRP-1; catalase B; DHICA oxidase; glycoprotein 75; melanoma antigen gp75; CAS2; TYRP; b-PROTEIN; |
Gene ID | 7306 |
mRNA Refseq | NM_000550 |
Protein Refseq | NP_000541 |
MIM | 115501 |
UniProt ID | P17643 |
◆ Recombinant Proteins | ||
TYRP1-17676M | Recombinant Mouse Tyrp1 Protein, His-tagged | +Inquiry |
TYRP1-2963H | Recombinant Human TYRP1 Protein, MYC/DDK-tagged | +Inquiry |
RFL5115HF | Recombinant Full Length Human 5,6-Dihydroxyindole-2-Carboxylic Acid Oxidase(Tyrp1) Protein, His-Tagged | +Inquiry |
TYRP1-2288H | Recombinant Human TYRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TYRP1-883HFL | Recombinant Full Length Human TYRP1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYRP1-1641HCL | Recombinant Human TYRP1 cell lysate | +Inquiry |
TYRP1-473HCL | Recombinant Human TYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYRP1 Products
Required fields are marked with *
My Review for All TYRP1 Products
Required fields are marked with *