Recombinant Human TYW5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TYW5-6594H
Product Overview : C2orf60 MS Standard C13 and N15-labeled recombinant protein (NP_001034782) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TYW5 (TRNA-YW Synthesizing Protein 5) is a Protein Coding gene. Diseases associated with TYW5 include Mixed Sleep Apnea and Familial Isolated Hypoparathyroidism. Among its related pathways are Gene Expression and tRNA processing. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and tRNA binding. An important paralog of this gene is HSPBAP1.
Molecular Mass : 36.5 kDa
AA Sequence : MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TYW5 tRNA-yW synthesizing protein 5 [ Homo sapiens (human) ]
Official Symbol TYW5
Synonyms TYW5; tRNA-yW synthesizing protein 5; C2orf60, chromosome 2 open reading frame 60; tRNA wybutosine-synthesizing protein 5; FLJ37953; tRNA yW-synthesizing enzyme 5; jmjC domain-containing protein C2orf60; hTYW5; C2orf60; MGC70509;
Gene ID 129450
mRNA Refseq NM_001039693
Protein Refseq NP_001034782
UniProt ID A2RUC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TYW5 Products

Required fields are marked with *

My Review for All TYW5 Products

Required fields are marked with *

0
cart-icon