Recombinant Human TYW5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TYW5-6594H |
Product Overview : | C2orf60 MS Standard C13 and N15-labeled recombinant protein (NP_001034782) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TYW5 (TRNA-YW Synthesizing Protein 5) is a Protein Coding gene. Diseases associated with TYW5 include Mixed Sleep Apnea and Familial Isolated Hypoparathyroidism. Among its related pathways are Gene Expression and tRNA processing. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and tRNA binding. An important paralog of this gene is HSPBAP1. |
Molecular Mass : | 36.5 kDa |
AA Sequence : | MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TYW5 tRNA-yW synthesizing protein 5 [ Homo sapiens (human) ] |
Official Symbol | TYW5 |
Synonyms | TYW5; tRNA-yW synthesizing protein 5; C2orf60, chromosome 2 open reading frame 60; tRNA wybutosine-synthesizing protein 5; FLJ37953; tRNA yW-synthesizing enzyme 5; jmjC domain-containing protein C2orf60; hTYW5; C2orf60; MGC70509; |
Gene ID | 129450 |
mRNA Refseq | NM_001039693 |
Protein Refseq | NP_001034782 |
UniProt ID | A2RUC4 |
◆ Recombinant Proteins | ||
TYW5-9804M | Recombinant Mouse TYW5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tyw5-6762M | Recombinant Mouse Tyw5 Protein, Myc/DDK-tagged | +Inquiry |
TYW5-6594H | Recombinant Human TYW5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TYW5-17680M | Recombinant Mouse TYW5 Protein | +Inquiry |
TYW5-7069H | Recombinant Human TYW5, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYW5-8070HCL | Recombinant Human C2orf60 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TYW5 Products
Required fields are marked with *
My Review for All TYW5 Products
Required fields are marked with *