Recombinant Human UBA6 Protein, GST-tagged
Cat.No. : | UBA6-4225H |
Product Overview : | Human FLJ10808 full-length ORF ( AAH31637, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM |
Molecular Mass : | 68.31 kDa |
AA Sequence : | MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UBA6 ubiquitin-like modifier activating enzyme 6 [ Homo sapiens ] |
Official Symbol | UBA6 |
Synonyms | UBA6; ubiquitin-like modifier activating enzyme 6; UBE1L2, ubiquitin activating enzyme E1 like 2; ubiquitin-like modifier-activating enzyme 6; FLJ10808; ubiquitin activating enzyme E1; monocyte protein 4; ubiquitin-activating enzyme 6; UBA6, ubiquitin-activating enzyme E1; ubiquitin-activating enzyme E1-like 2; ubiquitin-activating enzyme E1-like protein 2; E1-L2; MOP-4; UBE1L2; FLJ23367; |
Gene ID | 55236 |
mRNA Refseq | NM_018227 |
Protein Refseq | NP_060697 |
MIM | 611361 |
UniProt ID | A0AVT1 |
◆ Recombinant Proteins | ||
UBA6-46H | Recombinant Rat Vascular Endothelial Growth Factor A | +Inquiry |
UBA6-525H | Recombinant Human UBA6 Protein, His-tagged | +Inquiry |
UBA6-149H | Active Recombinant Human UBA6, GST-tagged | +Inquiry |
UBA6-0048H | Recombinant Human UBA6 Protein (E2-D1052), Tag Free | +Inquiry |
UBA6-0049H | Recombinant Human UBA6 Protein (E2-D1052), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBA6-602HCL | Recombinant Human UBA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBA6 Products
Required fields are marked with *
My Review for All UBA6 Products
Required fields are marked with *