Recombinant Human UBB protein, GST-tagged
| Cat.No. : | UBB-8785H |
| Product Overview : | Recombinant Human UBB protein(103-229 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 103-229 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | UBB ubiquitin B [ Homo sapiens ] |
| Official Symbol | UBB |
| Synonyms | UBB; ubiquitin B; polyubiquitin-B; FLJ25987; MGC8385; polyubiquitin B; UBC; UBA52; RPS27A; |
| mRNA Refseq | NM_018955 |
| Protein Refseq | NP_061828 |
| MIM | 191339 |
| UniProt ID | P0CG47 |
| Gene ID | 7314 |
| ◆ Recombinant Proteins | ||
| UBB-04H | Recombinant Human ubiquitin B Protein, His tagged, Phosphorylated on Ser 65 | +Inquiry |
| UBB-8785H | Recombinant Human UBB protein, GST-tagged | +Inquiry |
| UBB-4865R | Recombinant Rhesus Macaque UBB Protein, His (Fc)-Avi-tagged | +Inquiry |
| UBB-5537C | Recombinant Chicken UBB | +Inquiry |
| UBB-9817M | Recombinant Mouse UBB Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBB Products
Required fields are marked with *
My Review for All UBB Products
Required fields are marked with *
