Recombinant Human UBB protein, GST-tagged
Cat.No. : | UBB-1848H |
Product Overview : | Recombinant Human UBB protein(103-229 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 103-229 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UBB ubiquitin B [ Homo sapiens ] |
Official Symbol | UBB |
Synonyms | UBB; ubiquitin B; polyubiquitin-B; FLJ25987; MGC8385; polyubiquitin B; UBC; UBA52; RPS27A; |
Gene ID | 7314 |
mRNA Refseq | NM_018955 |
Protein Refseq | NP_061828 |
MIM | 191339 |
UniProt ID | P0CG47 |
◆ Recombinant Proteins | ||
UBB-2079Z | Recombinant Zebrafish UBB | +Inquiry |
UBB-42H | Recombinant Human UBB Protein, His-tagged, phosphorylated | +Inquiry |
UBB-6391R | Recombinant Rat UBB Protein | +Inquiry |
UBB-002H | Active Recombinant Human UBB Protein, His-tagged | +Inquiry |
UBB-1848H | Recombinant Human UBB protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBB Products
Required fields are marked with *
My Review for All UBB Products
Required fields are marked with *