Recombinant Human UBD protein, GST-tagged
| Cat.No. : | UBD-1213H |
| Product Overview : | Recombinant Human UBD protein(1-165 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-165 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | UBD ubiquitin D [ Homo sapiens ] |
| Official Symbol | UBD |
| Synonyms | UBD; ubiquitin D; FAT10; diubiquitin; ubiquitin-like protein FAT10; UBD-3; GABBR1; |
| Gene ID | 10537 |
| mRNA Refseq | NM_006398 |
| Protein Refseq | NP_006389 |
| MIM | 606050 |
| UniProt ID | O15205 |
| ◆ Recombinant Proteins | ||
| UBD-6048R | Recombinant Rat UBD Protein, His (Fc)-Avi-tagged | +Inquiry |
| UBD-6392R | Recombinant Rat UBD Protein | +Inquiry |
| UBD-937H | Active Recombinant Human UBD | +Inquiry |
| UBD-3642H | Recombinant Human UBD protein, His-SUMO-tagged | +Inquiry |
| UBD-7866H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *
