Recombinant Human UBD protein, GST-tagged
Cat.No. : | UBD-1213H |
Product Overview : | Recombinant Human UBD protein(1-165 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-165 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UBD ubiquitin D [ Homo sapiens ] |
Official Symbol | UBD |
Synonyms | UBD; ubiquitin D; FAT10; diubiquitin; ubiquitin-like protein FAT10; UBD-3; GABBR1; |
Gene ID | 10537 |
mRNA Refseq | NM_006398 |
Protein Refseq | NP_006389 |
MIM | 606050 |
UniProt ID | O15205 |
◆ Recombinant Proteins | ||
UBD-849H | Recombinant Human Ubiquitin D, His-tagged | +Inquiry |
UBD-1213H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
UBD-5553H | Recombinant Human UBD Protein (Met1-Gly165), His tagged | +Inquiry |
UBD-17702M | Recombinant Mouse UBD Protein | +Inquiry |
UBD-301272H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *
0
Inquiry Basket