Recombinant Human UBD protein, His-SUMO-tagged
| Cat.No. : | UBD-3642H |
| Product Overview : | Recombinant Human UBD protein(O15205)(1-165aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-165aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.5 kDa |
| AA Sequence : | MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | UBD ubiquitin D [ Homo sapiens ] |
| Official Symbol | UBD |
| Synonyms | UBD; ubiquitin D; FAT10; diubiquitin; ubiquitin-like protein FAT10; UBD-3; GABBR1; |
| Gene ID | 10537 |
| mRNA Refseq | NM_006398 |
| Protein Refseq | NP_006389 |
| MIM | 606050 |
| UniProt ID | O15205 |
| ◆ Recombinant Proteins | ||
| Ubd-6778M | Recombinant Mouse Ubd Protein, Myc/DDK-tagged | +Inquiry |
| UBD-9819M | Recombinant Mouse UBD Protein, His (Fc)-Avi-tagged | +Inquiry |
| UBD-938H | Active Recombinant Human UBD | +Inquiry |
| UBD-937H | Active Recombinant Human UBD | +Inquiry |
| UBD-28355TH | Recombinant Human UBD, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *
