Recombinant Human UBD protein, His-SUMO-tagged
Cat.No. : | UBD-3642H |
Product Overview : | Recombinant Human UBD protein(O15205)(1-165aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-165aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 34.5 kDa |
AA Sequence : | MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | UBD ubiquitin D [ Homo sapiens ] |
Official Symbol | UBD |
Synonyms | UBD; ubiquitin D; FAT10; diubiquitin; ubiquitin-like protein FAT10; UBD-3; GABBR1; |
Gene ID | 10537 |
mRNA Refseq | NM_006398 |
Protein Refseq | NP_006389 |
MIM | 606050 |
UniProt ID | O15205 |
◆ Recombinant Proteins | ||
UBD-17702M | Recombinant Mouse UBD Protein | +Inquiry |
UBD-2247H | Recombinant Human UBD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBD-1213H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
Ubd-6778M | Recombinant Mouse Ubd Protein, Myc/DDK-tagged | +Inquiry |
UBD-936H | Recombinant Human UBD Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *