Recombinant Human UBD protein, His-tagged
| Cat.No. : | UBD-7865H |
| Product Overview : | Recombinant Human UBD protein(11-103 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 11-103 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | HVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHL |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | UBD ubiquitin D [ Homo sapiens ] |
| Official Symbol | UBD |
| Synonyms | UBD; ubiquitin D; FAT10; diubiquitin; ubiquitin-like protein FAT10; UBD-3; GABBR1; |
| mRNA Refseq | NM_006398 |
| Protein Refseq | NP_006389 |
| MIM | 606050 |
| UniProt ID | O15205 |
| Gene ID | 10537 |
| ◆ Recombinant Proteins | ||
| UBD-7865H | Recombinant Human UBD protein, His-tagged | +Inquiry |
| UBD-1213H | Recombinant Human UBD protein, GST-tagged | +Inquiry |
| UBD-937H | Active Recombinant Human UBD | +Inquiry |
| UBD-6392R | Recombinant Rat UBD Protein | +Inquiry |
| UBD-849H | Recombinant Human Ubiquitin D, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBD-596HCL | Recombinant Human UBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBD Products
Required fields are marked with *
My Review for All UBD Products
Required fields are marked with *
