Recombinant Human UBE2C protein, GST-tagged

Cat.No. : UBE2C-3527H
Product Overview : Recombinant Human UBE2C protein(1-179 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability November 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-179 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name UBE2C ubiquitin-conjugating enzyme E2C [ Homo sapiens ]
Official Symbol UBE2C
Synonyms UBE2C; ubiquitin-conjugating enzyme E2C; ubiquitin-conjugating enzyme E2 C; UBCH10; ubiquitin-protein ligase C; ubiquitin carrier protein C; ubiquitin carrier protein E2-C; cyclin-selective ubiquitin carrier protein; mitotic-specific ubiquitin-conjugating enzyme; dJ447F3.2;
Gene ID 11065
mRNA Refseq NM_007019
Protein Refseq NP_008950
MIM 605574
UniProt ID O00762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2C Products

Required fields are marked with *

My Review for All UBE2C Products

Required fields are marked with *

0
cart-icon
0
compare icon