Recombinant Human UBE2C protein, GST-tagged
Cat.No. : | UBE2C-3527H |
Product Overview : | Recombinant Human UBE2C protein(1-179 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | July 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-179 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | UBE2C ubiquitin-conjugating enzyme E2C [ Homo sapiens ] |
Official Symbol | UBE2C |
Synonyms | UBE2C; ubiquitin-conjugating enzyme E2C; ubiquitin-conjugating enzyme E2 C; UBCH10; ubiquitin-protein ligase C; ubiquitin carrier protein C; ubiquitin carrier protein E2-C; cyclin-selective ubiquitin carrier protein; mitotic-specific ubiquitin-conjugating enzyme; dJ447F3.2; |
Gene ID | 11065 |
mRNA Refseq | NM_007019 |
Protein Refseq | NP_008950 |
MIM | 605574 |
UniProt ID | O00762 |
◆ Recombinant Proteins | ||
UBE2C-3585Z | Recombinant Zebrafish UBE2C | +Inquiry |
UBE2C-10H | Recombinant Human Ubiquitin Conjugating Enzyme 10,His-tagged | +Inquiry |
UBE2C-792HFL | Recombinant Full Length Human UBE2C Protein, C-Flag-tagged | +Inquiry |
UBE2C-2295H | Recombinant Human UBE2C Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2C-221H | Recombinant Full Length Human UBE2C, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2C-592HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
UBE2C-591HCL | Recombinant Human UBE2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2C Products
Required fields are marked with *
My Review for All UBE2C Products
Required fields are marked with *