Recombinant Human UBE2C protein, GST-tagged

• Cat.No.: UBE2C-3527H
• Product Overview: Recombinant Human UBE2C protein(1-179 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-179 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: UBE2C ubiquitin-conjugating enzyme E2C [ Homo sapiens ]
• Official Symbol: UBE2C
• Synonyms: UBE2C; ubiquitin-conjugating enzyme E2C; ubiquitin-conjugating enzyme E2 C; UBCH10; ubiquitin-protein ligase C; ubiquitin carrier protein C; ubiquitin carrier protein E2-C; cyclin-selective ubiquitin carrier protein; mitotic-specific ubiquitin-conjugating enzyme; dJ447F3.2
• Gene ID: 11065
• mRNA Refseq: NM_007019
• Protein Refseq: NP_008950
• MIM: 605574
• UniProt ID: O00762