Recombinant Human UBE2D2 protein, GST-tagged

Cat.No. : UBE2D2-301587H
Product Overview : Recombinant Human UBE2D2 (1-59 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Asp59
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ]
Official Symbol UBE2D2
Synonyms UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B; ubiquitin-protein ligase D2; ubiquitin carrier protein D2; ubiquitin-conjugating enzyme E2(17)KB 2; ubiquitin-conjugating enzyme E2-17 kDa 2; ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5); PUBC1; UBC4/5; UBCH5B; E2(17)KB2;
Gene ID 7322
mRNA Refseq NM_003339
Protein Refseq NP_003330
MIM 602962
UniProt ID P62837

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2D2 Products

Required fields are marked with *

My Review for All UBE2D2 Products

Required fields are marked with *

0
cart-icon