Recombinant Human UBE2D3
Cat.No. : | UBE2D3-30045TH |
Product Overview : | Recombinant Full Length Human UBE2D3 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-147; 147 amino acids, 16.7kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-147 a.a. |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGP NDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPD DPLVPEIARIYKTDRDKYNRISREWTQKYAM |
Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. |
Full Length : | Full L. |
Gene Name | UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ] |
Official Symbol | UBE2D3 |
Synonyms | UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; |
Gene ID | 7323 |
mRNA Refseq | NM_003340 |
Protein Refseq | NP_003331 |
MIM | 602963 |
Uniprot ID | P61077 |
Chromosome Location | 4q24 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Canonical NF-kappaB pathway, organism-specific biosystem; |
Function | ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
UBE2D3-1882H | Recombinant Human UBE2D3 | +Inquiry |
UBE2D3-5056R | Recombinant Rhesus monkey UBE2D3 Protein, His-tagged | +Inquiry |
UBE2D3-205H | Recombinant Human UBE2D3, His-tagged | +Inquiry |
UBE2D3-122H | Recombinant Human UBE2D3 | +Inquiry |
UBE2D3-004H | Recombinant Human UBE2D3 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
UBE2D3-585HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2D3 Products
Required fields are marked with *
My Review for All UBE2D3 Products
Required fields are marked with *