Recombinant Human UBE2D3 protein, His-SUMO-tagged

Cat.No. : UBE2D3-3643H
Product Overview : Recombinant Human UBE2D3 protein(P61077)(1-147aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-147aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.7 kDa
AA Sequence : MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name UBE2D3 ubiquitin-conjugating enzyme E2D 3 [ Homo sapiens ]
Official Symbol UBE2D3
Synonyms UBE2D3; ubiquitin-conjugating enzyme E2D 3; ubiquitin conjugating enzyme E2D 3 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D3; UbcH5C; E2(17)KB 3; ubiquitin-protein ligase D3; ubiquitin carrier protein D3; ubiquitin-conjugating enzyme E2(17)KB 3; ubiquitin-conjugating enzyme E2-17 kDa 3; ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5); UBC4/5; UBCH5C; E2(17)KB3; MGC5416; MGC43926;
Gene ID 7323
mRNA Refseq NM_003340
Protein Refseq NP_003331
MIM 602963
UniProt ID P61077

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2D3 Products

Required fields are marked with *

My Review for All UBE2D3 Products

Required fields are marked with *

0
cart-icon