Recombinant Human UBE2I Protein, 1-158aa, GST-tagged
Cat.No. : | UBC9-3525H |
Product Overview : | Recombinant Human UBE2I Protein (1-158aa) with GST tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-158 a.a. |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | ~ 44.8KDa, reducing conditions |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS |
Purity : | > 90% as determined by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.54 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in PBS, pH 8.0 |
Gene Name | UBE2I ubiquitin conjugating enzyme E2 I [ Homo sapiens (human) ] |
Official Symbol | UBE2I |
Synonyms | UBE2I; ubiquitin conjugating enzyme E2 I; P18; UBC9; C358B7.1; SUMO-conjugating enzyme UBC9; ; RING-type E3 SUMO transferase UBC9; SUMO-1-protein ligase; SUMO-protein ligase; ubiquitin carrier protein 9; ubiquitin carrier protein I; ubiquitin conjugating enzyme 9; ubiquitin conjugating enzyme E2I; ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast); ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9); ubiquitin-conjugating enzyme UbcE2A; ubiquitin-like protein SUMO-1 conjugating enzyme; ubiquitin-protein ligase E2I; ubiquitin-protein ligase I; ; EC 6.3.2.19 |
Gene ID | 7329 |
mRNA Refseq | NM_194259 |
Protein Refseq | NP_919235 |
MIM | 601661 |
UniProt ID | P63279 |
◆ Recombinant Proteins | ||
UBC9-3525H | Recombinant Human UBE2I Protein, 1-158aa, GST-tagged | +Inquiry |
Ubc9-14H | Recombinant Human Ubiquitin Conjugating Enzyme 9, His | +Inquiry |
UBC9-3407H | Recombinant Human UBC9 protein, His-tagged | +Inquiry |
UBC9-3524H | Recombinant Human UBC9, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBC9 Products
Required fields are marked with *
My Review for All UBC9 Products
Required fields are marked with *
0
Inquiry Basket