Recombinant Human UBE2I protein, GST-tagged
Cat.No. : | UBE2I-002H |
Product Overview : | Recombinant Human UBE2I fused with GST tag at N-terminal was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Form : | Supplied as a 0.2 µM filtered solution of 50mM HEPES, 150mM NaCl, pH 7.5 |
Molecular Mass : | 44.4kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFGFVAVP |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | UBE2I ubiquitin conjugating enzyme E2I [ Homo sapiens (human) ] |
Official Symbol | UBE2I |
Synonyms | P18; UBC9; C358B7.1;SUMO-conjugating enzyme UBC9; RING-type E3 SUMO transferase UBC9; SUMO-protein ligase; Ubiquitin carrier protein 9; Ubiquitin carrier protein I; Ubiquitin-conjugating enzyme E2 I; Ubiquitin-protein ligase I; UBE2I; |
Gene ID | 7329 |
mRNA Refseq | NM_194261 |
Protein Refseq | NP_919237 |
MIM | 601661 |
UniProt ID | P63279 |
◆ Recombinant Proteins | ||
UBE2I-6057R | Recombinant Rat UBE2I Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2I-5062R | Recombinant Rhesus monkey UBE2I Protein, His-tagged | +Inquiry |
UBE2I-0009H | Recombinant Human UBE2I Protein (S2-S158), Tag Free | +Inquiry |
UBE2I-17719M | Recombinant Mouse UBE2I Protein | +Inquiry |
UBE2I-4522H | Recombinant Human UBE2I protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2I-574HCL | Recombinant Human UBE2I 293 Cell Lysate | +Inquiry |
UBE2I-573HCL | Recombinant Human UBE2I 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2I Products
Required fields are marked with *
My Review for All UBE2I Products
Required fields are marked with *
0
Inquiry Basket