Recombinant Human UBE2N Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UBE2N-1221H
Product Overview : UBE2N MS Standard C13 and N15-labeled recombinant protein (NP_003339) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
Molecular Mass : 17.1 kDa
AA Sequence : MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UBE2N ubiquitin-conjugating enzyme E2N [ Homo sapiens (human) ]
Official Symbol UBE2N
Synonyms UBE2N; ubiquitin-conjugating enzyme E2N; ubiquitin conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin conjugating enzyme E2N (UBC13 homolog, yeast); ubiquitin-conjugating enzyme E2 N; MGC8489; UBC13; UbcH ben; yeast UBC13 homolog; ubiquitin-protein ligase N; ubiquitin carrier protein N; bendless-like ubiquitin conjugating enzyme; bendless-like ubiquitin-conjugating enzyme; ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast); ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13); UbcH-ben; MGC131857;
Gene ID 7334
mRNA Refseq NM_003348
Protein Refseq NP_003339
MIM 603679
UniProt ID P61088

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2N Products

Required fields are marked with *

My Review for All UBE2N Products

Required fields are marked with *

0
cart-icon
0
compare icon