Recombinant Human UBE2N Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UBE2N-1221H
• Product Overview: UBE2N MS Standard C13 and N15-labeled recombinant protein (NP_003339) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.
• Molecular Mass: 17.1 kDa
• AA Sequence: MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UBE2N ubiquitin-conjugating enzyme E2N [ Homo sapiens (human) ]
• Official Symbol: UBE2N
• Synonyms: UBE2N; ubiquitin-conjugating enzyme E2N; ubiquitin conjugating enzyme E2N (homologous to yeast UBC13), ubiquitin conjugating enzyme E2N (UBC13 homolog, yeast); ubiquitin-conjugating enzyme E2 N; MGC8489; UBC13; UbcH ben; yeast UBC13 homolog; ubiquitin-protein ligase N; ubiquitin carrier protein N; bendless-like ubiquitin conjugating enzyme; bendless-like ubiquitin-conjugating enzyme; ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast); ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13); UbcH-ben; MGC131857
• Gene ID: 7334
• mRNA Refseq: NM_003348
• Protein Refseq: NP_003339
• MIM: 603679
• UniProt ID: P61088