Recombinant Human UBE2W Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBE2W-3408H |
Product Overview : | UBE2W MS Standard C13 and N15-labeled recombinant protein (NP_060769) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a nuclear-localized ubiquitin-conjugating enzyme (E2) that, along with ubiquitin-activating (E1) and ligating (E3) enzymes, coordinates the addition of a ubiquitin moiety to existing proteins. The encoded protein promotes the ubiquitination of Fanconi anemia complementation group proteins and may be important in the repair of DNA damage. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBE2W ubiquitin conjugating enzyme E2 W [ Homo sapiens (human) ] |
Official Symbol | UBE2W |
Synonyms | UBE2W; ubiquitin-conjugating enzyme E2W (putative); ubiquitin-conjugating enzyme E2 W; FLJ11011; ubiquitin-protein ligase W; ubiquitin carrier protein W; ubiquitin-conjugating enzyme 16; probable ubiquitin-conjugating enzyme E2 W; UBC16; UBC-16; hUBC-16; |
Gene ID | 55284 |
mRNA Refseq | NM_018299 |
Protein Refseq | NP_060769 |
MIM | 614277 |
UniProt ID | Q96B02 |
◆ Recombinant Proteins | ||
UBE2W-5070R | Recombinant Rhesus monkey UBE2W Protein, His-tagged | +Inquiry |
Ube2w-6801M | Recombinant Mouse Ube2w Protein, Myc/DDK-tagged | +Inquiry |
UBE2W-4230H | Recombinant Human UBE2W Protein, GST-tagged | +Inquiry |
UBE2W-4689H | Recombinant Human UBE2W protein, His-SUMO-tagged | +Inquiry |
UBE2W-0046H | Recombinant Human UBE2W Protein (A2-C151), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2W-558HCL | Recombinant Human UBE2W 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2W Products
Required fields are marked with *
My Review for All UBE2W Products
Required fields are marked with *
0
Inquiry Basket