Recombinant Human UBL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBL3-3197H |
Product Overview : | UBL3 MS Standard C13 and N15-labeled recombinant protein (NP_009037) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | UBL3 (Ubiquitin Like 3) is a Protein Coding gene. |
Molecular Mass : | 13 kDa |
AA Sequence : | MSSNVPADMINLRLILVSGKTKEFLFSHNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBL3 ubiquitin-like 3 [ Homo sapiens (human) ] |
Official Symbol | UBL3 |
Synonyms | UBL3; ubiquitin-like 3; PNSC1; ubiquitin-like protein 3; DKFZP434K151; FLJ32018; HCG 1; MUB; hsMUB; protein HCG-1; membrane-anchored ubiquitin-fold protein; HCG-1; DKFZp434K151; |
Gene ID | 5412 |
mRNA Refseq | NM_007106 |
Protein Refseq | NP_009037 |
MIM | 604711 |
UniProt ID | O95164 |
◆ Recombinant Proteins | ||
UBL3-5074R | Recombinant Rhesus monkey UBL3 Protein, His-tagged | +Inquiry |
UBL3-68H | Recombinant Human Ubiquitin-like 3, His-tagged | +Inquiry |
UBL3-81H | Recombinant Human Ubiquitin-Like 3, His-tagged | +Inquiry |
UBL3-6241H | Recombinant Human UBL3 protein, His-tagged | +Inquiry |
UBL3-6408R | Recombinant Rat UBL3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBL3-555HCL | Recombinant Human UBL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBL3 Products
Required fields are marked with *
My Review for All UBL3 Products
Required fields are marked with *