Recombinant Human UBL3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UBL3-3197H
• Product Overview: UBL3 MS Standard C13 and N15-labeled recombinant protein (NP_009037) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: UBL3 (Ubiquitin Like 3) is a Protein Coding gene.
• Molecular Mass: 13 kDa
• AA Sequence: MSSNVPADMINLRLILVSGKTKEFLFSHNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UBL3 ubiquitin-like 3 [ Homo sapiens (human) ]
• Official Symbol: UBL3
• Synonyms: UBL3; ubiquitin-like 3; PNSC1; ubiquitin-like protein 3; DKFZP434K151; FLJ32018; HCG 1; MUB; hsMUB; protein HCG-1; membrane-anchored ubiquitin-fold protein; HCG-1; DKFZp434K151
• Gene ID: 5412
• mRNA Refseq: NM_007106
• Protein Refseq: NP_009037
• MIM: 604711
• UniProt ID: O95164